PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv3_057700_ifwp.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 388aa    MW: 42862.6 Da    PI: 6.4546
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv3_057700_ifwp.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.53.8e-10191249563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l++e+
  Bv3_057700_ifwp.t1 191 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAEN 249
                         9*********************************************9998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.8E-16187251IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.932189252IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.8E-8189245No hitNo description
SuperFamilySSF579599.85E-11191242No hitNo description
PfamPF001708.6E-9191245IPR004827Basic-leucine zipper domain
CDDcd147031.68E-24192241No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MDKDKLAGGG LPPMGRFSAF SPSSSSPSSS LQQQQQTQTT SFSHDLSRMP DNPPKNMGHR  60
RAHSEILTLP DDISFDSDLG VVGGGHDGPS FSDETEEDLF SMYIDMDKVN SATSATSGFQ  120
AGEPSWGAGQ VAPGETGERP RARHQHSQSM DGTTLIKPEM LVSNGEEALP AEAKKAISAA  180
KLAELALIDP KRAKRIWANR QSAARSKERK MRYIAELERK VQTLQTEATS LSAQLTLLQR  240
DTNGLTAENS ELKLRLQTME QQVHLQDALN DALKEEIQHL KLLTGQAISN GGPMVNFPPS  300
FAANQSFYPN NQAMHTLLTA QQFQQLQIHS QKQQHQFQER QLHQLQQQQF QQQELSQHSG  360
DFKIRPSMPL PKENASDPNS GASKDERS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010672248.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-143POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0J8CPU30.0A0A0J8CPU3_BETVU; Uncharacterized protein
STRINGVIT_05s0102g01120.t011e-170(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-146bZIP family protein